- KCC4/SLC12A7 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-85133
- KCC4
- PBS (pH 7.2) and 40% Glycerol
- 0.1 ml (also 25ul)
- Unconjugated
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- KCC4/SLC12A7
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: AARTQAPPTP DKVQMTWTRE KLIAEKYRSR DTSLSGFKDL FSMKPDQSNV
- Human, Mouse
- solute carrier family 12 member 7
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
AARTQAPPTPDKVQMTWTREKLIAEKYRSRDTSLSGFKDLFSMKPDQSNV
Specifications/Features
Available conjugates: Unconjugated